— THE SITUATION —

Somewhere between the $9 red peppers and the $22 ground beef, grocery shopping became a hostile act. Overdraft Kitchen is the response. Meals that feed four for under $15, priced against what you're actually paying in Ottawa in 2026. No fancy ingredients, no wellness branding, no pretending this is fun. Just food that works when the math doesn't.

Under $15 Feeds Four People
400+ cal Per Serving
GF option On Every Recipe
101 recipes And Counting
The Recipes

Cheap dinners, fully itemized

101 SHOWN
Filter by
$3.51 /serving
$14.05 Total · 4 serv

Arroz con Pollo

Chicken thighs braised directly in seasoned rice and tomatoes until everything cooks together in one pot. A Latin staple that earns its place on any budget list.

4 SERVINGS · 556 CAL · 15 min PREP · 45 min COOK
chickenriceone-pothigh-proteinlatin
$3.29 /serving
$13.17 Total · 4 serv

Baked Beans and Sausage

White beans and sliced kielbasa simmered in a thick sweet-savory tomato sauce on the stovetop.

4 SERVINGS · 460 CAL · 10 min PREP · 35 min COOK
porkbeansone-potcomfort-foodgluten-freemeal-prep
$1.92 /serving
$7.66 Total · 4 serv

Bean and Cheese Burritos

Canned black beans mashed with cumin and garlic, rolled in flour tortillas with cheddar and warmed in a pan. Two burritos per person.

4 SERVINGS · 480 CAL · 10 min PREP · 15 min COOK
kid-friendlylunchvegetarianhigh-proteinfast
$3.13 /serving
$12.54 Total · 4 serv

Bean and Cheese Tostadas

Crunchy baked corn tortillas topped with seasoned refried beans, cheddar, and shredded lettuce. A Mexican-inspired staple that regularly tops budget meal lists on Reddit.

4 SERVINGS · 443 CAL · 15 min PREP · 15 min COOK
vegetarianbeansfastmexican-inspiredgluten-freehigh-fiber
$3.65 /serving
$14.58 Total · 4 serv

Beef and Barley Soup

Ground beef, pearl barley, and vegetables simmered in beef broth until the barley thickens the whole pot.

4 SERVINGS · 460 CAL · 10 min PREP · 50 min COOK
beefsoupone-potmeal-prepcomfort-foodfreezer-friendly
$3.49 /serving
$13.94 Total · 4 serv

Beef and Bean Rice Skillet

A filling one-pan rice and beef skillet with two kinds of beans. Reheats well and gets better the next day.

4 SERVINGS · 680 CAL · 10 min PREP · 30 min COOK
gluten-freebeefricebeanshigh-proteinone-pan
$2.97 /serving
$11.87 Total · 4 serv

Beefy Macaroni

Ground beef, elbow macaroni, and canned tomatoes cooked together in one pot — a from-scratch version of boxed hamburger helper.

4 SERVINGS · 540 CAL · 10 min PREP · 25 min COOK
beefpastaone-potkid-friendlycomfort-foodfast
$3.35 /serving
$13.38 Total · 4 serv

Bigos (Hunter's Stew)

Poland's national dish: sauerkraut slow-simmered with kielbasa, canned tomatoes, onion, cremini mushrooms, bay leaves, and allspice until deeply flavoured. Serve with bread.

4 SERVINGS · 410 CAL · 15 min PREP · 60 min COOK
polishporksoupmeal-prephigh-protein
$2.72 /serving
$10.87 Total · 4 serv

Black Bean and Cheese Quesadillas

Flour tortillas filled with seasoned black beans and melted cheddar. Quick, filling, and flexible.

4 SERVINGS · 683 CAL · 10 min PREP · 20 min COOK
vegetarianbeanscheesefastkid-friendly
$2.48 /serving
$9.91 Total · 4 serv

Black Bean Tacos

Spiced black beans in corn tortillas with a quick tomato topping and shredded cabbage. Four tacos per serving.

4 SERVINGS · 485 CAL · 10 min PREP · 15 min COOK
vegangluten-freebeanstacoshigh-fiberno-cook-optional
$2.26 /serving
$9.04 Total · 4 serv

Breakfast Burrito

Scrambled eggs, fried potato, and cheddar rolled in a tortilla. Two per person.

4 SERVINGS · 715 CAL · 10 min PREP · 20 min COOK
eggspotatobreakfast
$2.30 /serving
$9.18 Total · 4 serv

Burrito Bowl

Rice, two kinds of beans, and corn in one bowl. Cheap, filling, and vegan.

4 SERVINGS · 560 CAL · 10 min PREP · 25 min COOK
veganvegetariangluten-freebeansricehigh-fiber
$2.14 /serving
$8.56 Total · 4 serv

Cabbage and Kielbasa Skillet

Smoked sausage pan-fried with cabbage and potatoes. Simple, fast, and very cheap per serving.

4 SERVINGS · 460 CAL · 10 min PREP · 30 min COOK
gluten-freeporkcabbagepotatoesone-panlow-cost
$2.58 /serving
$10.32 Total · 4 serv

Cheap Chickpea Curry

A thick, spiced curry with chickpeas and canned tomatoes in coconut milk. Serve over rice.

4 SERVINGS · 580 CAL · 10 min PREP · 25 min COOK
vegangluten-freechickpeascurryricehigh-fiber
$2.82 /serving
$11.29 Total · 4 serv

Cheesy Broccoli Rice

Rice and broccoli cooked stovetop in chicken broth, then stirred with cheddar until melted.

4 SERVINGS · 470 CAL · 10 min PREP · 25 min COOK
vegetarianricekid-friendlycomfort-foodfast
$3.19 /serving
$12.74 Total · 4 serv

Chicken and Dumplings

Chicken thighs simmered with vegetables in a simple broth, topped with drop dumplings cooked directly in the pot.

4 SERVINGS · 510 CAL · 20 min PREP · 40 min COOK
chickensoupone-potcomfort-foodmeal-prep
$2.33 /serving
$9.31 Total · 4 serv

Chicken and Rice Soup

A simple broth-based soup with chicken thighs, rice, and vegetables. Works when you are sick, tired, or broke.

4 SERVINGS · 441 CAL · 15 min PREP · 40 min COOK
gluten-freechickenricesouphigh-protein
$2.87 /serving
$11.47 Total · 4 serv

Chicken Noodle Soup

Chicken thighs simmered with carrot, celery, and onion in broth, with pasta cooked directly in the pot.

4 SERVINGS · 430 CAL · 15 min PREP · 35 min COOK
chickensouppastakid-friendlycomfort-foodone-pot
$3.13 /serving
$12.51 Total · 4 serv

Chicken Tortilla Soup

Shredded chicken thighs with black beans, corn, and tomatoes in a spiced broth. A Tex-Mex staple that appears on virtually every budget meal-prep list.

4 SERVINGS · 410 CAL · 10 min PREP · 35 min COOK
chickenbeanssouptex-mexhigh-proteinmeal-prep
$2.75 /serving
$11.01 Total · 4 serv

Chickpea and Spinach Stew

A Spanish-style stew with chickpeas, frozen spinach, and smoked tomato broth over rice. Very filling, very cheap.

4 SERVINGS · 559 CAL · 10 min PREP · 30 min COOK
vegangluten-freechickpeasspinachricehigh-fiberhigh-iron
$1.25 /serving
$4.99 Total · 4 serv

Chili Oil Fried Eggs and Rice

Fried eggs finished in chili oil with soy sauce and sesame, served over rice. Went viral on TikTok for a reason — it takes ten minutes and costs almost nothing.

4 SERVINGS · 431 CAL · 5 min PREP · 10 min COOK
vegetarianeggsricefastvery-low-costmeal-prep
$1.42 /serving
$5.66 Total · 4 serv

Congee

Rice cooked slowly in broth until it breaks down into a thick, savoury porridge. One of the cheapest filling meals in existence, and popular on budget Reddit for exactly that reason.

4 SERVINGS · 408 CAL · 5 min PREP · 45 min COOK
ricesoupvery-low-costbreakfastgluten-freevegetarian
$2.27 /serving
$9.07 Total · 4 serv

Corn Chowder

Thick, creamy corn and potato soup with bacon. Uses canned and frozen corn to keep costs down and make it a year-round option.

4 SERVINGS · 421 CAL · 15 min PREP · 35 min COOK
soupporkpotatoescomfort-foodfast
$1.77 /serving
$7.06 Total · 4 serv

Creamy Tomato Pasta

Pasta in a quick tomato sauce finished with cream cheese for richness. Cheap, fast, and the most-saved recipe on Budget Bytes for years.

4 SERVINGS · 498 CAL · 5 min PREP · 20 min COOK
vegetarianpastafastvery-low-costcomfort-food
$1.84 /serving
$7.35 Total · 4 serv

Crispy Chickpea Rice Bowl

Pan-crisped spiced chickpeas over rice and vegetables. Vegan and filling.

4 SERVINGS · 575 CAL · 10 min PREP · 25 min COOK
veganvegetariangluten-freebeansricehigh-fiber
$2.24 /serving
$8.95 Total · 4 serv

Curried Potato and Chickpeas

Diced potatoes and chickpeas simmered in a spiced tomato and coconut milk sauce — a cheap, filling vegan curry.

4 SERVINGS · 420 CAL · 15 min PREP · 30 min COOK
veganvegetarianbeansone-potgluten-freericecomfort-foodmeal-prep
$2.30 /serving
$9.20 Total · 4 serv

Dal Makhani

Whole black lentils and kidney beans slow-cooked in a buttery, spiced tomato sauce. Different from yellow dal — richer, darker, and better suited to cold weather.

4 SERVINGS · 492 CAL · 10 min (plus overnight soaking for dried lentils) PREP · 1 hr COOK
vegetarianlentilsbeansriceindian-inspiredhigh-fiberlow-cost
$1.44 /serving
$5.75 Total · 4 serv

Egg and Cheese Breakfast Sandwich

Fried egg and melted cheddar on buttered toast. Ready in ten minutes.

4 SERVINGS · 470 CAL · 5 min PREP · 10 min COOK
eggsbreakfastquick
$1.28 /serving
$5.13 Total · 4 serv

Egg Fried Rice

Leftover or fresh rice stir-fried with eggs, frozen vegetables, and soy sauce. Ready in 20 minutes.

4 SERVINGS · 489 CAL · 5 min PREP · 20 min COOK
vegetarianriceeggsone-panfastlow-cost
$1.22 /serving
$4.87 Total · 4 serv

Egg Fried Rice Bowl

Uses day-old rice and whatever frozen vegetables you have. Ready in 15 minutes.

4 SERVINGS · 470 CAL · 5 min PREP · 12 min COOK
vegetarianriceeggsquick
$2.25 /serving
$8.98 Total · 4 serv

Egg Salad Sandwiches

Hard-boiled eggs mashed with mayonnaise and mustard, served on white bread. Two sandwiches per person.

4 SERVINGS · 430 CAL · 15 min PREP · 12 min COOK
kid-friendlylunchvegetarianhigh-proteinno-cook
$3.17 /serving
$12.67 Total · 4 serv

Filipino Chicken Adobo

Chicken thighs braised in soy sauce, vinegar, and garlic until the sauce reduces to a dark glaze. Consistently cited as the top answer in every 'what should I make for cheap' thread.

4 SERVINGS · 518 CAL · 10 min PREP · 40 min COOK
chickenricehigh-proteinfilipinomeal-prep
$0.98 /serving
$3.92 Total · 4 serv

French Toast

Bread, eggs, and milk fried in butter. The cheapest breakfast that still feels like one.

4 SERVINGS · 420 CAL · 5 min PREP · 15 min COOK
breakfastkid-friendlyvegetarianfastcheap
$1.43 /serving
$5.72 Total · 4 serv

French Toast Bake

Bread cubes soaked in a cinnamon egg custard and baked until puffed — breakfast for dinner at well under $5 total.

4 SERVINGS · 410 CAL · 10 min PREP · 35 min COOK
kid-friendlyvegetarianfastcomfort-food
$0.81 /serving
$3.22 Total · 4 serv

From-Scratch Pancakes

Flour, milk, and an egg. Cheaper than a boxed mix and takes the same ten minutes.

4 SERVINGS · 450 CAL · 10 min PREP · 15 min COOK
breakfastkid-friendlyvegetariancheap
$2.88 /serving
$11.52 Total · 4 serv

Greek Lemon Chicken Soup

A simplified avgolemono-style soup — chicken and rice in broth finished with beaten eggs and lemon juice for a silky, tangy texture.

4 SERVINGS · 400 CAL · 10 min PREP · 35 min COOK
chickensoupriceone-potgluten-freehigh-protein
$3.47 /serving
$13.87 Total · 4 serv

Ground Beef Chili

A thick, straightforward beef and kidney bean chili. Keeps for days and gets better the next morning.

4 SERVINGS · 530 CAL · 10 min PREP · 40 min COOK
gluten-freebeefbeanschilihigh-proteinfreezer-friendly
$3.35 /serving
$13.41 Total · 4 serv

Ground Turkey Taco Bowl

Taco-spiced turkey with black beans and corn over rice. Naturally gluten-free.

4 SERVINGS · 575 CAL · 10 min PREP · 25 min COOK
turkeyricebeanshigh-proteingluten-free
$2.34 /serving
$9.34 Total · 4 serv

Hoppin' John

Black-eyed peas cooked with smoked sausage, onion, and celery over rice. A Southern American staple that has been feeding people cheaply for a very long time.

4 SERVINGS · 476 CAL · 10 min PREP · 30 min COOK
beansriceporkone-potsouthernhigh-protein
$1.89 /serving
$7.57 Total · 4 serv

Huevos Rancheros Bowl

Fried eggs over saucy black beans and rice. A hot, savoury breakfast bowl.

4 SERVINGS · 480 CAL · 10 min PREP · 25 min COOK
vegetariangluten-freebreakfastbeansriceeggs
$2.76 /serving
$11.05 Total · 4 serv

Japanese Curry Rice

Chicken, potatoes, and carrots in a thick, mildly sweet curry sauce made from S&B Golden Curry roux, served over rice. One of the most-saved 'comfort food for cheap' recipes on TikTok and r/JapaneseFood.

4 SERVINGS · 578 CAL · 15 min PREP · 40 min COOK
chickenricecurryone-potjapanesehigh-protein
$3.03 /serving
$12.13 Total · 4 serv

Kapusniak (Sauerkraut Soup)

A Polish sauerkraut soup with kielbasa, potato, carrot, and onion simmered in chicken broth with bay leaves. Tangy, filling, and better the next day.

4 SERVINGS · 410 CAL · 15 min PREP · 40 min COOK
polishporksoupmeal-prep
$2.98 /serving
$11.94 Total · 4 serv

Kielbasa, Sauerkraut, and Potato

Sliced sausage and potatoes braised with sauerkraut and broth in a single pot — Eastern European weeknight food.

4 SERVINGS · 430 CAL · 10 min PREP · 35 min COOK
porkone-potcomfort-foodgluten-free
$1.36 /serving
$5.44 Total · 4 serv

Kopytka (Polish Potato Dumplings)

Boiled mashed potatoes mixed with flour and egg to make thick dumplings, then pan-fried in butter with caramelized onion and topped with sour cream.

4 SERVINGS · 510 CAL · 30 min PREP · 30 min COOK
polishvegetariancomfort-food
$3.22 /serving
$12.86 Total · 4 serv

Korean-Style Ground Beef Bowl

Ground beef with soy, sesame, garlic, and ginger over rice. One of the most-saved recipes on TikTok and r/MealPrepSunday for years running.

4 SERVINGS · 524 CAL · 10 min PREP · 15 min COOK
beefricefasthigh-proteinmeal-prep
$2.74 /serving
$10.95 Total · 4 serv

Kotlet Schabowy (Breaded Pork Cutlets)

Classic Polish breaded pork cutlets — floured, egged, and breaded then fried — served with mashed potatoes and a simple grated carrot salad.

4 SERVINGS · 620 CAL · 25 min PREP · 30 min COOK
polishporkhigh-proteincomfort-food
$1.65 /serving
$6.58 Total · 4 serv

Krupnik (Polish Barley Soup)

An ancient Polish peasant soup of pearl barley, potato, carrot, celery, and onion in chicken broth with bay leaves and dried marjoram. The barley thickens it as it cooks.

4 SERVINGS · 430 CAL · 15 min PREP · 45 min COOK
polishvegetariansoupmeal-prephigh-fiber
$1.01 /serving
$4.04 Total · 4 serv

Lentil and Rice Bowl (Mujadara)

Lentils, rice, and heavily browned onions. Costs about a dollar a serving.

4 SERVINGS · 515 CAL · 10 min PREP · 40 min COOK
veganvegetariangluten-freelentilsricehigh-fiber
$1.75 /serving
$6.98 Total · 4 serv

Lentil Bolognese

Green lentils slow-cooked with vegetables and tomato into a thick meat-sauce texture, served over pasta. A reliable vegan weeknight staple on every budget food forum.

4 SERVINGS · 511 CAL · 10 min PREP · 40 min COOK
veganpastalentilslow-costmeal-prephigh-fiber
$2.66 /serving
$10.63 Total · 4 serv

Lentil Tomato Soup

A thick, spiced red lentil soup with tomato and vegetables. Cheap, high in protein and fiber, and freezes well.

4 SERVINGS · 510 CAL · 10 min PREP · 35 min COOK
vegangluten-freelentilssouphigh-fiberfreezer-friendly
$2.93 /serving
$11.73 Total · 4 serv

Loaded Baked Potato Soup

Thick, creamy potato soup with bacon and cheddar. One of the top-rated recipes on Pinterest and Budget Bytes for years, and one of the better uses of a $4 bag of potatoes.

4 SERVINGS · 488 CAL · 15 min PREP · 35 min COOK
porkpotatoessoupcomfort-foodhigh-protein
$2.39 /serving
$9.57 Total · 4 serv

Minestrone

A thick Italian vegetable soup with kidney beans, pasta, and canned tomatoes — uses whatever cheap vegetables are on hand.

4 SERVINGS · 410 CAL · 15 min PREP · 30 min COOK
veganvegetarianbeanspastasoupone-potmeal-prep
$1.24 /serving
$4.97 Total · 4 serv

Mujaddara

Brown lentils and rice cooked together, topped with deeply caramelized onions — a Middle Eastern staple that costs almost nothing to make.

4 SERVINGS · 430 CAL · 10 min PREP · 55 min COOK
veganvegetarianbeansriceone-potgluten-freehigh-proteinmeal-prep
$3.17 /serving
$12.66 Total · 4 serv

Mushroom and Barley Soup

Cremini mushrooms, pearl barley, and root vegetables simmered in broth until the barley makes it thick and savory.

4 SERVINGS · 410 CAL · 15 min PREP · 50 min COOK
vegetariansoupone-potmeal-prepcomfort-foodfreezer-friendly
$2.39 /serving
$9.56 Total · 4 serv

Mushroom Stroganoff

Cremini mushrooms cooked in a creamy sour cream and broth sauce over egg noodles. The standard vegetarian weeknight option on every meal planning forum.

4 SERVINGS · 488 CAL · 10 min PREP · 25 min COOK
vegetarianpastamushroomsfastcomfort-food
$1.55 /serving
$6.22 Total · 4 serv

Omurice

Ketchup fried rice wrapped in a thin egg omelette. A Japanese comfort food that went viral on TikTok and costs under $1.60 per serving.

4 SERVINGS · 433 CAL · 10 min PREP · 20 min COOK
vegetarianeggsricefastvery-low-costjapanese
$3.35 /serving
$13.40 Total · 4 serv

One-Pan Chicken Thighs and Potatoes

Chicken thighs and potatoes roasted together on one pan with garlic and herbs. Minimal prep, almost no cleanup, and consistently one of the most-recommended beginner recipes online.

4 SERVINGS · 558 CAL · 15 min PREP · 45 min COOK
chickenpotatoesone-panhigh-proteinovengluten-free
$3.13 /serving
$12.52 Total · 4 serv

One-Pot Sausage Pasta

Sliced kielbasa and pasta cooked together in a tomato-broth sauce, all in one pot with nothing drained.

4 SERVINGS · 530 CAL · 10 min PREP · 25 min COOK
porkpastaone-potfastcomfort-food
$0.82 /serving
$3.28 Total · 4 serv

Pasta Aglio e Olio

Spaghetti with garlic, olive oil, chili, and parmesan. Six ingredients, twenty minutes, one of the most repeated recipes on r/EatCheapAndHealthy.

4 SERVINGS · 548 CAL · 5 min PREP · 15 min COOK
vegetarianpastafastvery-low-costitalian
$1.86 /serving
$7.45 Total · 4 serv

Pasta alla Vodka

Rigatoni in a creamy tomato sauce with garlic, butter, and a splash of vodka. The recipe that went viral on TikTok in 2020 and never really left.

4 SERVINGS · 543 CAL · 10 min PREP · 25 min COOK
vegetarianpastalow-costfastitalian
$2.50 /serving
$10.01 Total · 4 serv

Pasta and Bean Soup

A thick Italian-style soup with two kinds of beans, pasta, and tomatoes. Very filling and cheap.

4 SERVINGS · 548 CAL · 10 min PREP · 30 min COOK
veganbeanspastasouphigh-fiberitalian
$1.91 /serving
$7.63 Total · 4 serv

Pasta e Ceci

An Italian chickpea and pasta soup that lands somewhere between a stew and a broth. Cheap, filling, and made entirely from pantry staples.

4 SERVINGS · 422 CAL · 10 min PREP · 30 min COOK
veganpastachickpeassoupitalianhigh-fiberlow-cost
$1.03 /serving
$4.10 Total · 4 serv

Pasta Salad

Rotini tossed with diced cucumber, tomato, and a simple oil-and-vinegar dressing with dried herbs. Served cold. Keeps well for two days.

4 SERVINGS · 415 CAL · 15 min PREP · 10 min COOK
kid-friendlylunchvegetarianveganmeal-prepcold
$0.90 /serving
$3.59 Total · 4 serv

Peanut Butter Banana Overnight Oats

Oats soaked overnight with peanut butter, banana, and milk. No cooking.

4 SERVINGS · 625 CAL · 10 min PREP · 0 min COOK
vegetarianbreakfastno-cookmake-ahead
$0.85 /serving
$3.39 Total · 4 serv

Peanut Butter Noodles

Pasta tossed in a peanut butter and soy sauce dressing with garlic and ginger. Extremely cheap and quick.

4 SERVINGS · 526 CAL · 10 min PREP · 12 min COOK
veganpastapeanut-butterfastvery-low-cost
$1.12 /serving
$4.48 Total · 4 serv

Peanut Butter Oatmeal

Rolled oats cooked in milk with peanut butter and brown sugar. The cheapest filling breakfast on this site.

4 SERVINGS · 531 CAL · 2 min PREP · 10 min COOK
vegetarianbreakfastoatspeanut-buttervery-low-costfast
$0.99 /serving
$3.96 Total · 4 serv

Peanut Noodle Bowl

Pantry peanut sauce over noodles and frozen vegetables. Serve warm or cold.

4 SERVINGS · 540 CAL · 10 min PREP · 12 min COOK
veganvegetarianpastaquick
$2.12 /serving
$8.49 Total · 4 serv

Pork and Cabbage Rice Bowl

Ground pork fried down with shredded cabbage over rice. Cheap and quick.

4 SERVINGS · 535 CAL · 10 min PREP · 20 min COOK
porkricecabbage
$1.75 /serving
$7.00 Total · 4 serv

Pork Fried Rice

Ground pork, egg, and frozen vegetables fried with day-old rice in soy sauce and sesame oil.

4 SERVINGS · 490 CAL · 10 min PREP · 20 min COOK
porkricefastmeal-prepgluten-free
$1.43 /serving
$5.72 Total · 4 serv

Potato and Egg Hash

Diced potatoes pan-fried with onion, peppers, and eggs. Works for breakfast, lunch, or dinner.

4 SERVINGS · 470 CAL · 10 min PREP · 30 min COOK
gluten-freeeggspotatoesvegetarianbreakfastone-pan
$2.58 /serving
$10.31 Total · 4 serv

Pulled Chicken Rice Bowls

Chicken thighs simmered in a smoky tomato sauce until shreddable, served over rice.

4 SERVINGS · 530 CAL · 10 min PREP · 40 min COOK
chickenriceone-potmeal-prepgluten-freehigh-proteincomfort-food
$2.03 /serving
$8.13 Total · 4 serv

Red Beans and Rice

Slow-simmered red kidney beans with smoked sausage, celery, and onion over white rice. A classic cheap meal.

4 SERVINGS · 540 CAL · 10 min PREP · 35 min COOK
gluten-freebeansriceporkcajunhigh-protein
$2.08 /serving
$8.31 Total · 4 serv

Red Lentil Coconut Soup

Red lentils cooked with coconut milk, tomatoes, and curry spices into a thick, warming soup. A different direction from the yellow dal already on this site.

4 SERVINGS · 419 CAL · 10 min PREP · 30 min COOK
veganlentilscoconutsoupgluten-freehigh-fiberlow-cost
$1.89 /serving
$7.54 Total · 4 serv

Rice and Peas

Jamaican-style kidney beans cooked with rice in coconut milk and thyme. Rich, filling, and naturally vegan.

4 SERVINGS · 490 CAL · 5 min PREP · 30 min COOK
vegangluten-freericebeanscoconutjamaicanvery-low-cost
$1.76 /serving
$7.04 Total · 4 serv

Sardine Pasta

Pasta with canned sardines, tomatoes, garlic, and chili. Faster than it sounds, cheaper than it tastes.

4 SERVINGS · 517 CAL · 5 min PREP · 20 min COOK
fishpastafasthigh-proteinlow-cost
$1.47 /serving
$5.88 Total · 4 serv

Saucy Beans on Toast

Homemade tomato beans piled on buttered toast. A whole meal from two cans and a loaf.

4 SERVINGS · 430 CAL · 5 min PREP · 20 min COOK
vegetarianbeansfastcheapone-pan
$3.27 /serving
$13.09 Total · 4 serv

Sausage and Lentil Soup

Sliced kielbasa, green lentils, and vegetables simmered in broth until thick and filling.

4 SERVINGS · 490 CAL · 10 min PREP · 40 min COOK
porksoupone-potmeal-prephigh-proteincomfort-food
$2.23 /serving
$8.94 Total · 4 serv

Sausage and Potato Soup

A thick, smoky soup with kielbasa, potatoes, and vegetables. The kind of thing that fixes a bad day.

4 SERVINGS · 414 CAL · 15 min PREP · 35 min COOK
porkpotatoessouphigh-calorieone-pot
$1.23 /serving
$4.93 Total · 4 serv

Savoury Cheddar Oatmeal Bowl

Oats cooked like a risotto with cheddar and a soft egg on top. Not sweet.

4 SERVINGS · 520 CAL · 5 min PREP · 15 min COOK
vegetariangluten-freebreakfasteggs
$2.98 /serving
$11.92 Total · 4 serv

Shakshuka

Eggs poached directly in a spiced tomato and chickpea sauce. One pan, minimal cleanup, ready in 30 minutes.

4 SERVINGS · 495 CAL · 10 min PREP · 25 min COOK
vegetariangluten-freeeggstomatoeschickpeasone-pan
$2.78 /serving
$11.12 Total · 4 serv

Spaghetti with Meat Sauce

Ground beef simmered with crushed tomatoes, onion, and garlic over spaghetti — no heat, no frills.

4 SERVINGS · 560 CAL · 10 min PREP · 30 min COOK
beefpastakid-friendlycomfort-foodmeal-prep
$2.69 /serving
$10.74 Total · 4 serv

Spiced Chickpea and Tomato Stew

Chickpeas and cabbage simmered in a cumin-spiced tomato broth with a squeeze of lemon at the end.

4 SERVINGS · 520 CAL · 10 min PREP · 30 min COOK
veganvegetarianbeanssoupstewone-potgluten-freehigh-proteinmeal-prep
$1.49 /serving
$5.97 Total · 4 serv

Spicy Pork Noodles

Ground pork and spaghetti tossed in a garlicky soy and sesame sauce with chili flakes and green onion.

4 SERVINGS · 520 CAL · 10 min PREP · 20 min COOK
porkpastafasthigh-protein
$1.53 /serving
$6.13 Total · 4 serv

Split Pea Soup

A thick, filling green split pea soup with carrots and celery. High in protein and fiber, very low cost.

4 SERVINGS · 410 CAL · 10 min PREP · 50 min COOK
vegangluten-freelentilssouphigh-fiberhigh-proteinfreezer-friendly
$1.38 /serving
$5.51 Total · 4 serv

Stovetop Mac and Cheese

Real cheese sauce made from scratch over macaroni. Cheaper than the box stuff and considerably better.

4 SERVINGS · 678 CAL · 5 min PREP · 20 min COOK
vegetarianpastacheesefastvery-low-costkid-friendly
$1.89 /serving
$7.57 Total · 4 serv

Sweet Potato and Black Bean Bowl

Roasted sweet potato and black beans over rice. Vegan and naturally gluten-free.

4 SERVINGS · 500 CAL · 10 min PREP · 35 min COOK
veganvegetariangluten-freebeansricehigh-fiber
$2.89 /serving
$11.55 Total · 4 serv

Sweet Potato and Black Bean Soup

Diced sweet potatoes and black beans simmered in a spiced tomato broth until thick.

4 SERVINGS · 410 CAL · 15 min PREP · 30 min COOK
veganvegetarianbeanssoupone-potgluten-freehigh-protein
$3.56 /serving
$14.25 Total · 4 serv

Taco Soup

Ground beef, beans, corn, and canned tomatoes simmered with taco spices. One of the most-saved recipes on Pinterest and Reddit for years, and it's obvious why.

4 SERVINGS · 460 CAL · 10 min PREP · 25 min COOK
beefbeanssoupfasthigh-proteinmeal-prep
$3.55 /serving
$14.20 Total · 4 serv

Teriyaki Chicken Rice

Chicken breasts glazed in a soy, brown sugar, and garlic sauce, served over rice.

4 SERVINGS · 540 CAL · 10 min PREP · 30 min COOK
chickenricefastmeal-prepgluten-free
$2.74 /serving
$10.94 Total · 4 serv

Teriyaki Chicken Rice Bowl

Chicken and rice with a quick homemade teriyaki sauce. No bottled sauce needed.

4 SERVINGS · 475 CAL · 10 min PREP · 20 min COOK
chickenricehigh-protein
$1.48 /serving
$5.90 Total · 4 serv

Tofu and Vegetable Stir-Fry

Crispy pan-fried tofu with frozen vegetables and a peanut-soy sauce over rice. Fully vegan and under $6.

4 SERVINGS · 442 CAL · 15 min PREP · 25 min COOK
vegantofuricestir-fryhigh-proteinlow-cost
$1.47 /serving
$5.88 Total · 4 serv

Tomato and Egg over Rice

The classic Chinese home dish — soft eggs in a quick tomato sauce over rice. Cheap, fast, comforting.

4 SERVINGS · 440 CAL · 10 min PREP · 15 min COOK
vegetarianeggsricefastkid-friendly
$2.51 /serving
$10.02 Total · 4 serv

Tomato Orzo Soup

A simple tomato broth soup with small pasta and cabbage, seasoned with Italian herbs.

4 SERVINGS · 430 CAL · 10 min PREP · 25 min COOK
veganvegetarianpastasoupone-potfast
$2.57 /serving
$10.27 Total · 4 serv

Tomato Soup and Grilled Cheese

Two cans of condensed tomato soup made with milk, served with pan-fried cheddar sandwiches on white bread. Four servings of each.

4 SERVINGS · 490 CAL · 5 min PREP · 20 min COOK
kid-friendlylunchvegetarianfastcomfort-food
$2.36 /serving
$9.45 Total · 4 serv

Tuna Melts

Open-faced sandwiches with canned tuna mixed with mayo, topped with cheddar and toasted under the broiler. Two halves per person.

4 SERVINGS · 445 CAL · 10 min PREP · 5 min COOK
kid-friendlylunchhigh-proteinfast
$2.18 /serving
$8.72 Total · 4 serv

Tuna Noodle Casserole

Pasta, canned tuna, frozen peas, and cream of mushroom soup baked with a breadcrumb topping. Classic comfort food.

4 SERVINGS · 492 CAL · 10 min PREP · 35 min COOK
tunapastacasseroleovenhigh-protein
$1.70 /serving
$6.79 Total · 4 serv

Tuna Rice Bowl

Canned tuna, rice, and corn in a soy dressing. A no-cook-protein pantry bowl.

4 SERVINGS · 485 CAL · 10 min PREP · 15 min COOK
fishricehigh-protein
$1.98 /serving
$7.91 Total · 4 serv

Tuscan White Bean and Kale Soup

Cannellini beans and kale in a garlicky tomato broth with small pasta. A regular recommendation on r/EatCheapAndHealthy and Budget Bytes.

4 SERVINGS · 418 CAL · 10 min PREP · 30 min COOK
veganbeanssoupkalehigh-fiberlow-cost
$3.59 /serving
$14.35 Total · 4 serv

Unstuffed Cabbage Roll Soup

All the ingredients of a cabbage roll — ground beef, rice, cabbage, tomatoes — cooked together in one pot without the rolling. Popular on Reddit as a lazy version of a classic.

4 SERVINGS · 490 CAL · 15 min PREP · 35 min COOK
beefcabbagericesoupone-potcomfort-foodhigh-protein
$1.35 /serving
$5.41 Total · 4 serv

Veggie Lo Mein

Spaghetti stir-fried with cabbage, carrot, and egg in a soy-sesame sauce — a budget version of takeout lo mein.

4 SERVINGS · 400 CAL · 15 min PREP · 15 min COOK
vegetarianpastafastmeal-prep
$1.47 /serving
$5.89 Total · 4 serv

Yellow Lentil Dal

A spiced yellow lentil dish with tomato and onion, served over rice. One of the cheapest filling meals you can make.

4 SERVINGS · 553 CAL · 10 min PREP · 35 min COOK
vegangluten-freelentilsricehigh-fibervery-low-costindian
NO MATCHES

Nothing fits that combo yet. Try fewer filters.